Skip to main content

Cathepsin D Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP1-85562

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-85562

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for Cathepsin D Antibody

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGT

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (86%)

Marker

Lysosomes Marker

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Cathepsin D Antibody

Western Blot: Cathepsin D Antibody [NBP1-85562] - Analysis in human cell line SK-BR-3.
Immunohistochemistry-Paraffin: Cathepsin D Antibody [NBP1-85562] - Staining of human small intestine shows moderate to strong granular cytoplasmic positivity in glandular and lymphoid cells.
Immunohistochemistry-Paraffin: Cathepsin D Antibody [NBP1-85562] - Staining of human skeletal muscle shows occasional granular cytoplasmic positivity in a subset of myocytes.

Applications for Cathepsin D Antibody

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Cathepsin D

Cathepsin D has been reported to be involved in malignant tumour progression and with prognosis of various human cancers.

Alternate Names

CTSD

Gene Symbol

CTSD

Additional Cathepsin D Products

Product Documents for Cathepsin D Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Cathepsin D Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...