Skip to main content

Cathepsin D Antibody (3F12-1B9), Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # H00001509-M01

Catalog #
Availability
Size / Price
Qty
Loading...
H00001509-M01

Key Product Details

Species Reactivity

Human

Applications

ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin, Immunoprecipitation, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 3F12-1B9

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for Cathepsin D Antibody (3F12-1B9)

Immunogen

CTSD (AAH16320, 26 a.a. ~ 412 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL

Specificity

CTSD - cathepsin D (lysosomal aspartyl protease)

Marker

Lysosomes Marker

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for Cathepsin D Antibody (3F12-1B9)

Western Blot: Cathepsin D Antibody (3F12-1B9) [H00001509-M01] - Analysis of CTSD expression in transfected 293T cell line by CTSD monoclonal antibody (M01), clone 3F12-1B9.Lane 1: CTSD transfected lysate (Predicted MW: 44.6 KDa).Lane 2: Non-transfected lysate.
Immunohistochemistry-Paraffin: Cathepsin D Antibody (3F12-1B9) [H00001509-M01] - Analysis of monoclonal antibody to CTSD on formalin-fixed paraffin-embedded human testis. Antibody concentration 1.5 ug/ml.
Immunoprecipitation: Cathepsin D Antibody (3F12-1B9) [H00001509-M01] - Analysis of CTSD transfected lysate using anti-CTSD monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CTSD MaxPab rabbit polyclonal antibody.

Applications for Cathepsin D Antibody (3F12-1B9)

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Immunoprecipitation

1:10-1:500

Western Blot

1:500
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: Cathepsin D

This gene encodes a lysosomal aspartyl protease composed of a dimer of disulfide-linked heavy and light chains, both produced from a single protein precursor. This proteinase, which is a member of the peptidase C1 family, has a specificity similar to but narrower than that of pepsin A. Transcription of this gene is initiated from several sites, including one which is a start site for an estrogen-regulated transcript. Mutations in this gene are involved in the pathogenesis of several diseases, including breast cancer and possibly Alzheimer disease.

Alternate Names

CTSD

Entrez Gene IDs

1509 (Human)

Gene Symbol

CTSD

OMIM

116840 (Human)

Additional Cathepsin D Products

Product Documents for Cathepsin D Antibody (3F12-1B9)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Cathepsin D Antibody (3F12-1B9)

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...