Skip to main content

ABH1 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # H00008846-B01P

Catalog #
Availability
Size / Price
Qty
Loading...
H00008846-B01P

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Mouse IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for ABH1 Antibody

Immunogen

ALKBH1 (AAH25787.1, 1 a.a. - 389 a.a.) full-length human protein. MGKMAAAVGSVATLATEPGEDAFRKLFRFYRQSRPGTADLEGVIDFSAAHAARGKGPGAQKVIKSQLNVSSVSEQNAYRAGLQPVSKWQAYGLKGYPGFIFIPNPFLPGYQWHWVKQCLKLYSQKPNVCNLDKHMSKEETQDLWEQSKEFLRYKEATKRRPRSLLEKLRWVTVGYHYNWDSKKYSADHYTPFPSDLGFLSEQVAAACGFEDFRAEAGILNYYRLDSTLGIHVDRSELDHSKPLLSFSFGQSAIFLLGGLQRDEAPTAMFMHSGDIMIMSGFSRLLNHAVPRVLPNPEGEGLPHCLEAPLPAVLPRDSMVEPCSMEDWQVCASYLKTARVNMTVRQVLATDQNFPLEPIEDEKRDISTEGFCHLDDQNSEVKRARINPHS

Clonality

Polyclonal

Host

Mouse

Isotype

IgG

Description

Quality control test: Antibody reactive against mammalian transfected lysate.

Scientific Data Images for ABH1 Antibody

Western Blot: ABH1 Antibody [H00008846-B01P] - Analysis of ALKBH1 expression in transfected 293T cell line by ALKBH1 polyclonal antibody. Lane 1: ALKBH transfected lysate(42.79 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: ABH1 Antibody [H00008846-B01P] - Analysis of purified antibody to ALKBH on HeLa cell. (antibody concentration 10 ug/ml)
Immunohistochemistry-Paraffin: ABH1 Antibody [H00008846-B01P] - Analysis of purified antibody to ALKBH1 on formalin-fixed paraffin-embedded human skeletal muscle. (antibody concentration 3 ug/ml)

Applications for ABH1 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry-Paraffin

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
This antibody is useful for WB, Functional, IF and IHC-P.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Protein G purified

Formulation

PBS (pH 7.4)

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: ABH1

ABH1 encodes a homolog to the E. coli alkB gene product. The E. coli alkB protein is part of the adaptive response mechanism of DNA alkylation damage repair. It is involved in damage reversal by oxidative demethylation of 1-methyladenine and 3-methylcytosine.

Alternate Names

ABH1, ABHalkB, alkylation repair homolog (E. coli), ALKB, alkB, alkylation repair homolog 1 (E. coli), ALKBH, alkylated DNA repair protein alkB homolog 1, alkylation repair, alkB homolog, Alpha-ketoglutarate-dependent dioxygenase ABH1, DNA lyase ABH1, EC 1.14.11.-, EC 4.2.99.18, hABH

Gene Symbol

ALKBH1

Additional ABH1 Products

Product Documents for ABH1 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ABH1 Antibody

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...