β-Lipotropin 61-91

Name: β-Lipotropin 61-91
Brand: Tocris Bioscience
SKU: 8984

Tocris Bioscience, part of Bio-Techne | Catalog # 8984

COA / SDS

Endogenous opioid peptide; component of the LIP cocktail for preconditioning human β-cells

Key Product Details

Description:	Endogenous opioid peptide; component of the LIP cocktail for preconditioning human β-cells
Alternative Names:	β-Endorphin
Purity:	≥95% (HPLC)
Molecular Weight:	3465.03

View Full Technical Details for β-Lipotropin 61-91

Technical Data
Citations

Biological Activity for β-Lipotropin 61-91

β-Lipotropin 61-91 (or β-Endorphin) is an endogenous opioid peptide with potent antinociceptive activity, physiologically released in response to painful stimuli.

β-Lipotropin 61-91 can be used to study the expression of μ-opioid receptor in organ cultures and to investigate cardiovascular regulation.

In combination with 10 μM Prostaglandin E2 (Cat. No. 2296) and 1 μg/mL IGF-1, β-Lipotropin 61-91 (0.01 μM) constitutes the LIP cocktail, a small molecule mixture used to precondition human β-cells and primary islets, significantly enhancing function and survival when transplanted subcutaneously to female mice.

Technical Data for β-Lipotropin 61-91

M. Wt	3465.03
Formula	C₁₅₈H₂₅₁N₃₉O₄₆S
Single Letter Sequence	YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
Storage	Store at -20°C
Purity	≥95% (HPLC)
CAS Number	61214-51-5
PubChem ID	16132316
InChi Key	JMHFFDIMOUKDCZ-NTXHZHDSSA-N
Smiles	O=C(NCC(NCC(N[C@@H](CC1=CC=CC=C1)C(N[C@@H](CCSC)C(N[C@@H]([C@H](O)C)C(N[C@@H](CO)C(N[C@@H](CCC(O)=O)C(N[C@@H](CCCCN)C(N[C@@H](CO)C(N[C@@H](CCC(N)=O)C(N[C@@H]([C@H](O)C)C(N2[C@@H](CCC2)C(N[C@@H](CC(C)C)C(N[C@@H](C(C)C)C(N[C@@H]([C@H](O)C)C(N[C@@H](CC(C)C)C(N[C@@H](CC3=CC=CC=C3)C(N[C@@H](CCCCN)C(N[C@@H](CC(N)=O)C(N[C@@H](C)C(N[C@@H]([C@@H](C)CC)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](CCCCN)C(N[C@@H](CC(N)=O)C(N[C@@H](C)C(N[C@@H](CC4=CC=C(C=C4)O)C(N[C@@H](CCCCN)C(N[C@@H](CCCCN)C(NCC(N[C@@H](CCC(O)=O)C(O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)[C@H](CC5=CC=C(C=C5)O)N

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility for β-Lipotropin 61-91

Solubility

Soluble to 1mg/ml in 20% ethanol / water

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Dilution Calculator

Calculate the dilution required to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

References for β-Lipotropin 61-91

References are publications that support the biological activity of the product.

Bloom Endorphins: profound behavioral effects in rats suggest new etiological factors in mental illness. Science 1976 PMID: 185694
Hill The effects of beta-endorphin (beta-END) on cardiovascular and behavioral dynamics in conscious rats. Brain Res.Bull 2002 PMID: 12372545
Vandana ChemPerturb-seq screen identifies a small molecule cocktail enhancing human beta cell survival after subcutaneous transplantation. CellStemCell 2025 PMID: 40562034