Skip to main content

MKRN3 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-84320PEP

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-84320PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MKRN3.

Source: E. coli

Amino Acid Sequence: SGRKMATEGGVSPPGASAGGGPSTAAHIEPPTQEVAEAPPAASSLSLPVIGSAAERGFFEAERDNADRGAAGGAGVESWADAIEFVPGQPYRGRWVASA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84320.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-84320PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: MKRN3

MKRN3, also known as Probable E3 ubiquitin-protein ligase makorin-3, is a 507 amino acid protein that is 56 kDa, contains a RING (C3HC4) zinc finger motif and several C3H zinc finger motifs, and acts as a catalyzer of the covalent attachment of ubiquitin moieties onto substrate proteins. Current research is being performed on this protein involvement in Prader-Willi syndrome, Angelman syndrome, Canavan disease, and intellectual disability. This protein is necessary for protein ubiquitination forming interaction with TSG101, UBE2D2, UBE2D3, UBE2I, UBE2N, UBE2V1, UBE2W, UBE2U, UBE2D1, UBE2D4, UBE2E1, UBE2E2, UBE2H, UBE2K, UBE2L3, UBE2V2, UBE2E3, C11orf57, ENKD1, LRSAM1, MDM2, and over 20 other proteins.

Alternate Names

EC 6.3.2.-, makorin ring finger protein 3, MGC88288, RNF63D15S9, ZFP127RING finger protein 63, Zinc finger protein 127, ZNF127probable E3 ubiquitin-protein ligase makorin-3

Gene Symbol

MKRN3

Additional MKRN3 Products

Product Documents for MKRN3 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MKRN3 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...