Skip to main content

LAP (TGF-beta 1) Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-21360PEP

Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-21360PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LAP (TGF-beta 1)

Source: E.coli

Amino Acid Sequence: EWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFTTGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21360. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP3-21360PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: LAP (TGF-beta 1)

TGF-beta 1 is expressed as a proprotein that is cleaved within the trans-Golgi to yield a latency-associated peptide (LAP) and the mature TGF-beta 1. Disulfide-linked homodimers of LAP and TGF-beta 1 remain noncovalently associated after secretion, forming the small latent TGF-beta 1 complex. Purified LAP can also associate with active TGF-beta and neutralize TGF-beta activity. Covalent linkage of LAP to one of three latent TGF-beta binding proteins (LTBPs) creates a large latent complex that can interact with the extracellular matrix. TGF-beta activation from latency is controlled by multiple factors including Plasmin, MMP-9, Thrombospondin-1, and various Integrins. The TGF-beta 1 LAP is capable of complexing with and inactivating all other human TGF-beta isoforms and those of most other species.

Long Name

Latency-associated Peptide

Alternate Names

LAP (TGFbeta 1)

Gene Symbol

TGFB1

Additional LAP (TGF-beta 1) Products

Product Documents for LAP (TGF-beta 1) Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for LAP (TGF-beta 1) Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...