Skip to main content

EMR3 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-86454PEP

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-86454PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EMR3.

Source: E. coli

Amino Acid Sequence: NASCVNNTHCTCNHGYTSGSGQKLFTFPLETCNDINECTPPYSVYCGFNAVCYNVEGSFYCQCVPGYRLHSGNEQFSNSNENTCQDTTSSKTTEGRKELQKIVDKFESLLTNQTLWRTEGRQEISSTATTILRDVESKVL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86454.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-86454PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: EMR3

EMR3 is an Orphan-B GPCR with an unknown ligand. Two variants are produced by alternative splicing. One form encodes a 652-amino acid GPCR consisting of two EGF-like domains and a mucin stalk, while the other is a truncated soluble form containing only two EGF-like domains. EMR3 and EMR2 share a high degree of sequence identity in the transmembrane domains. EMR3 has been reported to be expressed in neutrophils, monocytes, and macrophages. ESTs have been isolated from liver/spleen and mixed libraries.

Long Name

EGF-like Module Containing, Mucin-like, Hormone Receptor-like 3

Alternate Names

egf-like module containing, mucin-like, hormone receptor-like 3, EGF-like module receptor 3, EGF-like module-containing mucin-like hormone receptor-like 3, egf-like module-containing mucin-like receptor 3

Gene Symbol

ADGRE3

Additional EMR3 Products

Product Documents for EMR3 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for EMR3 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...