Skip to main content

ARNT2 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-88623PEP

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-88623PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ARNT2.

Source: E. coli

Amino Acid Sequence: GKDILEFCHPEDQSHLRESFQQVVKLKGQVLSVMYRFRTKNREWMLIRTSSFTFQNPYSDEIEYIICTNTNVKQLQQQQAELEVHQRDGLSSYDLSQVPVPNLPAGVHEAGKSVEKADAIFS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88623.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-88623PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: ARNT2

AhR, Arnt 1, Arnt 2 and BMAL1 are members of a family of transcription factors that contain a basic helix-loop-helix motif and a common "PAS" motif. The aromatic (aryl) hydrocarbon receptor, AhR, is a ligand dependent transcription factor that interacts with specific DNA sequences termed xenobiotic responsive elements (XREs) to activate several genes including CYP1A1, glutathione S-transferase Ya subunit and DT-diaphorase. The Ah receptor nuclear translocator proteins (Arnt 1 or Arnt 2) are required for ligand-dependent nuclear translocation of the Ah receptor and are also necessary for Ah receptor binding to the XRE element. BMAL1 (Brain and Muscle Arnt-like protein 1), also designated Arnt 3, TIC, JAP3 or MOP-3, has been shown to dimerize with Clock and bind to the promoter region of mPer1, suggesting that this protein plays a role in regulation of circadian oscillation in mammals.

Alternate Names

ARNT protein 2, aryl-hydrocarbon receptor nuclear translocator 2, bHLHe1BHLHE1, Class E basic helix-loop-helix protein 1, KIAA0307aryl hydrocarbon receptor nuclear translocator 2

Gene Symbol

ARNT2

Additional ARNT2 Products

Product Documents for ARNT2 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ARNT2 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...