Skip to main content

Recombinant Human 15-Lipoxygenase 1 GST (N-Term) Protein, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # H00000246-P01

Catalog #
Availability
Size / Price
Qty
Loading...
H00000246-P01-25ug
H00000246-P01-10ug

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Functional Assay, Microarray, Western Blot

Product Specifications

Description

A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-662 of Human ALOX15 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MGLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLWPARGKETELKVEVPEYLGPLLFVKLRKRHLLKDDAWFCNWISVQGPGAGDEVRFPCYRWVEGNGVLSLPEGTGRTVGEDPQGLFQKHREEELEERRKLYRWGNWKDGLILNMAGAKLYDLPVDERFLEDKRVDFEVSLAKGLADLAIKDSLNVLTCWKDLDDFNRIFWCGQSKLAERVRDSWKEDALFGYQFLNGANPVVLRRSAHLPARLVFPPGMEELQAQLEKELEGGTLFEADFSLLDGIKANVILCSQQHLAAPLVMLKLQPDGKLLPMVIQLQLPRTGSPPPPLFLPTDPPMAWLLAKCWVRSSDFQLHELQSHLLRGHLMAEVIVVATMRCLPSIHPIFKLIIPHLRYTLEINVRARTGLVSDMGIFDQIMSTGGGGHVQLLKQAGAFLTYSSFCPPDDLADRGLLGVKSSFYPQDALRLWEIIYRYVEGIVSLHYKTDVAVKDDPELQTWCREITEIGLQGAQDRGFPVSLQARDQVCHFVTMCIFTCTGQHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASLQMSITWQLGRRQPVMVAVGQHEEEYFSGPEPKAVLKKFREELAALDKEIEIRNAKLDMPYEYLRPSVVENSVAI

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

98.56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Application Notes

Functional assay and in vitro assay reported in scientific literature.

Protein / Peptide Type

Full Length Recombinant Protein

Scientific Data Images for Recombinant Human 15-Lipoxygenase 1 GST (N-Term) Protein

SDS-Page: Recombinant Human 15-Lipoxygenase 1 Protein [H00000246-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00000246-P01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: 15-Lipoxygenase 1

ALOX15( AAH29032, 1 a.a. - 663 a.a.) recombinant protein with GST.

Long Name

Polyunsaturated fatty acid lipoxygenase ALOX15

Alternate Names

12-LOX, 12/15-lipoxygenase, 15-LOX, 15-LOX-1, ALOX15, EC 1.13.11.12, LOG15

Gene Symbol

ALOX15

Additional 15-Lipoxygenase 1 Products

Product Documents for Recombinant Human 15-Lipoxygenase 1 GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Recombinant Human 15-Lipoxygenase 1 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...