Skip to main content

TGF-beta RIII Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP1-89988

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-89988
NBP1-89988-25ul

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for TGF-beta RIII Antibody

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: GYSGMDVTLLDPTCKAKMNGTHFVLESPLNGCGTRPRWSALDGVVYYNSIVIQVPALGDSSGWPDGYEDLESGDNGFPGDMDEGDASLFTRPEIVVFNCSLQQVRNPSSFQEQPHGNITFNMELYNTDLF

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24658685)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TGF-beta RIII Antibody

Immunohistochemistry-Paraffin: TGF-beta RIII Antibody [NBP1-89988] - Staining of human kidney shows medium membranous positivity in cells in glomeruli.

Applications for TGF-beta RIII Antibody

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Published Applications

Read 3 publications using NBP1-89988 in the following applications:

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TGF-beta RIII

Transforming growth factor (TGF)-beta is a multifunctional cytokine that modulates several tissue development and repair processes, including cell differentiation, cell cycle progression, cellular migration, adhesion, and extracellular matrix production. Three TGF-beta forms are encoded by separate genes: TGFB1 (MIM 190180), TGFB2 (MIM 190220), and TGFB3 (MIM 190230). The diverse effects of TGF-beta are mediated by the TGF-beta receptors and cell surface-binding proteins. Three TGF-beta receptors exist: type I (TGFBR1; MIM 190181), type II (TFGBR2; MIM 190182), and type III (TGFBR3). TGFBR3 is a glycoprotein that binds TGFB and exists in both a membrane-bound and a soluble form (Johnson et al., 1995 [PubMed 8530052]).

Long Name

Transforming Growth Factor beta Receptor III

Alternate Names

Betaglycan, BGCAN, TBRIII, TGF-bRIII, TGFbetaRIII, TGFBR3

Gene Symbol

TGFBR3

Additional TGF-beta RIII Products

Product Documents for TGF-beta RIII Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for TGF-beta RIII Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...