Skip to main content

TBC1D17 Antibody

Catalog # NBP2-83622 | Novus Biologicals a Bio-Techne Brand
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-83622-0.1ml

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

Product Summary for TBC1D17 Antibody

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse TBC1D17. Peptide sequence: FCGFMELVHGNFEESQETMKRQLGQLLLLLRVLDQPLCDFLDSQDSGSLC The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for TBC1D17 Antibody

Western Blot: TBC1D17 Antibody [NBP2-83622] - Host: Rabbit. Target Name: Tbc1d17. Sample Type: Mouse Thymus lysates. Antibody Dilution: 1.0ug/ml

Applications for TBC1D17 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TBC1D17

Alternate Names

TBC1 Domain Family, Member 17

Gene Symbol

TBC1D17

Product Documents for TBC1D17 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for TBC1D17 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...