I am looking for an antibody of STEAP2 and find that there are 3 different STEAP2 antisera on the product list. But the information of antigen is not very clear for these products. Because STEAP2 has several isoforms, I wonder if you can clarify which isoform can be detected by each antibody. I will appreciate it if you can tell me the peptide sequence of each antigen.

We have four STEAP2 antibodies and typically if the immunogen is not provided on the datasheet than it is deemed proprietary by the lab and cannot be provided. For catalog number NBP1-83100 however the immunogen is EYLASLFPDSLIVKGFNVVSAWALQLGPKD ASRQVYICSNNIQARQQVIELARQLNFIPI DLGSLSSAREIE For the other products I would have to get in touch with the lab to see if it could detect isoform 1 or 2. I can also inquire if they can provide a range it targets in if that would be useful. Typically though if it is indicated as C-terminal it will be within the last 50 amino acids. Was there a particular species or isoform you were interested in?

NBP1-83100 reacts with all the isoforms. I want one that specific reacts with a 454-aa isoform (NP_001231874). Could you check whether you have this kind of product?

I had the lab take a look at all 4 antibodies we have against this target and unfortunately it looks like all of them either will recognize both the 454 aa isoform as well as the 490 amino acid isoform, or only recognize the 490 amino acid isoform and we do not have one that is specific for one or the other. I am sorry that I do not have better news to report. You will probably need to find an antibody that targets between 440 and 454 of the isoform of interest for it to have no cross reaction as that is the region that is not conserved.

STEAP2 Antibody (1114318) [PerCP]

Name: STEAP2 Antibody (1114318) [PerCP]
Brand: Novus Biologicals
SKU: FAB11742C

Novus Biologicals, part of Bio-Techne | Catalog # FAB11742C

Submit a review

Product Datasheet / COA / SDS

View Available Conjugates

Conjugate

Catalog #

Unconjugated

MAB11742

STEAP2 Antibody (1114318) [PerCP]

Novus Biologicals, part of Bio-Techne | Catalog # FAB11742C

Key Product Details

Species Reactivity

Applications

Label

Antibody Source

Concentration

View all STEAP2 Antibodies »

Product Specifications

Immunogen

Specificity

Clonality

Host

Isotype

Applications for STEAP2 Antibody (1114318) [PerCP]

Immunocytochemistry

Immunohistochemistry

Formulation, Preparation, and Storage

Purification

Formulation

Preservative

Concentration

Shipping

Stability & Storage

Background: STEAP2

Long Name

Alternate Names

Additional STEAP2 Products

Product Documents for STEAP2 Antibody (1114318) [PerCP]

Product Datasheets

COA

Certificate of Analysis

SDS

Product Specific Notices for STEAP2 Antibody (1114318) [PerCP]