Skip to main content

PLS1 Antibody - Azide and BSA Free

Catalog # NBP2-94642 | Novus Biologicals a Bio-Techne Brand
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-94642-0.02ml
NBP2-94642-0.1ml

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Summary for PLS1 Antibody - Azide and BSA Free

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human PLS1 (NP_001165783.1). MENSTTTISREELEELQEAFNKIDIDNSGYVSDYELQDLFKEASLPLPGYKVREIVEKILSVADSNKDGKISFEEFVSLMQELKSKDISKTFRKIINKREGITAIGGTST

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

70 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for PLS1 Antibody - Azide and BSA Free

Western Blot: PLS1 Antibody [NBP2-94642] - Analysis of extracts of various cell lines, using PLS1 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 3s.
Immunohistochemistry-Paraffin: PLS1 Antibody [NBP2-94642] - Paraffin-embedded rat kidney using PLS1 .
Immunohistochemistry-Paraffin: PLS1 Antibody [NBP2-94642] - Paraffin-embedded mouse kidney using PLS1 .

Applications for PLS1 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50-1:200

Western Blot

1:200-1:2000
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PLS1

Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified. Plastin 1 (otherwise known as Fimbrin) is a third distinct plastin isoform which is specifically expressed at high levels in the small intestine. The L isoform is expressed only in hemopoietic cell lineages, while the T isoform has been found in all other normal cells of solid tissues that have replicative potential (fibroblasts, endothelial cells, epithelial cells, melanocytes, etc.). However, L-plastin has been found in many types of malignant human cells of non-hemopoietic origin suggesting that its expression is induced accompanying tumorigenesis in solid tissues. Fimbrin is a 68-kD actin-bundling protein. [provided by RefSeq]

Alternate Names

fimbrin, I plastin, intestine specific plastin, Intestine-specific plastin, I-plastin, plastin 1, plastin 1 (I isoform), Plastin-1

Gene Symbol

PLS1

Product Documents for PLS1 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for PLS1 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...