Skip to main content

Novus Biologicals products are now on bio-techne.com

Better as one

mGluR8 Antibody (4A7), Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # H00002918-M06

Catalog #
Availability
Size / Price
Qty
Loading...
H00002918-M06

Key Product Details

Species Reactivity

Human

Applications

ELISA, Sandwich ELISA, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 4A7

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for mGluR8 Antibody (4A7)

Immunogen

GRM8 (NP_000836, 486 a.a. ~ 575 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KVIGHWTNQLHLKVEDMQWAHREHTHPASVCSLPCKPGERKKTVKGVPCCWHCERCEGYNYQVDELSCELCPLDQRPNMNRTGCQLIPII

Specificity

GRM8 (4A7)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for mGluR8 Antibody (4A7)

Sandwich ELISA: mGluR8 Antibody (4A7) [H00002918-M06] - Detection limit for recombinant GST tagged GRM8 is 0.3 ng/ml as a capture antibody.

Applications for mGluR8 Antibody (4A7)

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: mGluR8

L-glutamate is the major excitatory neurotransmitter in the central nervous system and activates both ionotropic and metabotropic glutamate receptors. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be perturbed in many neuropathologic conditions. The metabotropic glutamate receptors are a family of G protein-coupled receptors, that have been divided into 3 groups on the basis of sequence homology, putative signal transduction mechanisms, and pharmacologic properties. Group I includes GRM1 and GRM5 and these receptors have been shown to activate phospholipase C. Group II includes GRM2 and GRM3 while Group III includes GRM4, GRM6, GRM7 and GRM8. Group II and III receptors are linked to the inhibition of the cyclic AMP cascade but differ in their agonist selectivities. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.

Long Name

Metabotropic Glutamate Receptor 8

Alternate Names

GPRC1H, GRM8

Entrez Gene IDs

2918 (Human)

Gene Symbol

GRM8

OMIM

601116 (Human)

UniProt

Additional mGluR8 Products

Product Documents for mGluR8 Antibody (4A7)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for mGluR8 Antibody (4A7)

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...