Skip to main content

MDH2 Antibody

Catalog # NBP1-86036 | Novus Biologicals a Bio-Techne Brand
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-86036

Key Product Details

Validated by

Knockout/Knockdown, Independent Antibodies

Species Reactivity

Human, Mouse, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for MDH2 Antibody

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: VTTLDIVRANTFVAELKGLDPARVNVPVIGGHAGKTIIPLISQCTPKVDFPQDQLTALTGRIQEAGTEVVKAKAGAGSATLSM

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23334578)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MDH2 Antibody

Western Blot: MDH2 Antibody [NBP1-86036] - Analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1,. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Immunocytochemistry/Immunofluorescence: MDH2 Antibody [NBP1-86036] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MDH2 Antibody [NBP1-86036] - Staining of human colon.

Applications for MDH2 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
WB reported in scientific literature (PMID: 25763823). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Published Applications

Read 2 publications using NBP1-86036 in the following applications:

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MDH2

Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. The protein encoded by this gene is localized to the mitochondria and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria. [provided by RefSeq]

Long Name

Malate dehydrogenase, mitochondrial

Alternate Names

EC 1.1.1.37

Gene Symbol

MDH2

Product Documents for MDH2 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for MDH2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...