CS Citrate Synthase Antibody (4Z10Z8)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16438

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-16438-100ul
NBP3-16438-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 4Z10Z8 expressed in HEK293

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all CS Citrate Synthase Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 367-466 of human CS Citrate Synthase (O75390). HLPNDPMFKLVAQLYKIVPNVLLEQGKAKNPWPNVDAHSGVLLQYYGMTEMNYYTVLFGVSRALGVLAQLIWSRALGFPLERPKSMSTEGLMKFVDSKSG

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit CS Citrate Synthase Antibody (4Z10Z8) (NBP3-16438) is a recombinant monoclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for CS Citrate Synthase Antibody (4Z10Z8)

Western Blot: CS Citrate Synthase Antibody (4Z10Z8) [NBP3-16438]

Western Blot: CS Citrate Synthase Antibody (4Z10Z8) [NBP3-16438]

Western Blot: CS Citrate Synthase Antibody (4Z10Z8) [NBP3-16438] - Western blot analysis of extracts of Rat heart cells, using CS Citrate Synthase antibody (NBP3-16438) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.
Immunocytochemistry/ Immunofluorescence: CS Citrate Synthase Antibody (4Z10Z8) [NBP3-16438]

Immunocytochemistry/ Immunofluorescence: CS Citrate Synthase Antibody (4Z10Z8) [NBP3-16438]

Immunocytochemistry/Immunofluorescence: CS Citrate Synthase Antibody (4Z10Z8) [NBP3-16438] - Immunofluorescence analysis of NIH-3T3 cells using CS Citrate Synthase Rabbit mAb (NBP3-16438) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
CS Citrate Synthase Antibody (4Z10Z8)

Immunohistochemistry: CS Citrate Synthase Antibody (4Z10Z8) [NBP3-16438] -

Immunohistochemistry: CS Citrate Synthase Antibody (4Z10Z8) [NBP3-16438] - Immunohistochemistry analysis of CS Citrate Synthase in paraffin-embedded mouse kidney tissue using CS Citrate Synthase Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
View 3 more images

Applications for CS Citrate Synthase Antibody (4Z10Z8)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CS Citrate Synthase

The protein encoded by the CS Citrate Synthase gene is a Krebs tricarboxylic acid cycle enzyme that catalyzes the synthesis of citratefrom oxaloacetate and acetyl coenzyme A. The enzyme is found in nearly all cells capable of oxidative metablism. Thisprotein is nuclear encoded and transported into the mitochondrial matrix, where the mature form is found. (provided byRefSeq)

Long Name

CS Citrate Synthase

Alternate Names

citrate (Si)-synthase, citrate synthase, mitochondrial, EC 2.3.3.1

Gene Symbol

CS

Additional CS Citrate Synthase Products

Product Documents for CS Citrate Synthase Antibody (4Z10Z8)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for CS Citrate Synthase Antibody (4Z10Z8)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.