Skip to main content

Biglycan Antibody (4E1-1G7), Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # H00000633-M01

Catalog #
Availability
Size / Price
Qty
Loading...
H00000633-M01

Key Product Details

Species Reactivity

Validated:

Human

Applications

ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin, Immunoprecipitation, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 4E1-1G7

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for Biglycan Antibody (4E1-1G7)

Immunogen

BGN (AAH02416.1, 1 a.a. ~ 368 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MWPLWRLVSLLALSQALPFEQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLARVPSGLPDLKLLQVVYLHSNNITKVGVNDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK

Specificity

BGN - biglycan

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for Biglycan Antibody (4E1-1G7)

Western Blot: Biglycan Antibody (4E1-1G7) [H00000633-M01] - Analysis of BGN expression in transfected 293T cell line by BGN monoclonal antibody (M01), clone 4E1-1G7.Lane 1: BGN transfected lysate(41.7 KDa).Lane 2: Non-transfected lysate.
Immunohistochemistry-Paraffin: Biglycan Antibody (4E1-1G7) [H00000633-M01] - Analysis of monoclonal antibody to BGN on formalin-fixed paraffin-embedded human lung, adenosquamous cell carcinoma. Antibody concentration 1 ~ 10 ug/ml.
Western Blot: Biglycan Antibody (4E1-1G7) [H00000633-M01] - BGN monoclonal antibody (M01), clone 4E1-1G7 Analysis of BGN expression in HepG2.

Applications for Biglycan Antibody (4E1-1G7)

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Immunoprecipitation

1:10-1:500

Western Blot

1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: Biglycan

The protein encoded by this gene is a small cellular or pericellular matrix proteoglycan that is closely related in structure to two other small proteoglycans, decorin and fibromodulin. The encoded protein and decorin are thought to be the result of a gene duplication. Decorin contains one attached glycosaminoglycan chain, while this protein probably contains two chains. For this reason, this protein is called biglycan. This protein is thought to function in connective tissue metabolism by binding to collagen fibrils and transfering growth factor-beta. It may promote neuronal survival. This gene is a candidate gene for the Happle syndrome.

Alternate Names

BGN, DSPG1, PG-S1, SLRR1A

Entrez Gene IDs

633 (Human)

Gene Symbol

BGN

OMIM

301870 (Human)

Additional Biglycan Products

Product Documents for Biglycan Antibody (4E1-1G7)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Biglycan Antibody (4E1-1G7)

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...