Aspartate Aminotransferase Antibody (5J1B4)
Novus Biologicals, part of Bio-Techne | Catalog # NBP3-15347
Recombinant Monoclonal Antibody
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 5J1B4 expressed in HEK293
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 150-250 of human Aspartate Aminotransferase (NP_002070.1). AAGFKDIRSYRYWDAEKRGLDLQGFLNDLENAPEFSIVVLHACAHNPTGIDPTPEQWKQIASVMKHRFLFPFFDSAYQGFASGNLERDAWAIRYFVSEGFE
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
46 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
Novus Biologicals Rabbit Aspartate Aminotransferase Antibody (5J1B4) (NBP3-15347) is a recombinant monoclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
Scientific Data Images for Aspartate Aminotransferase Antibody (5J1B4)
![Western Blot: Aspartate Aminotransferase Antibody (5J1B4) [NBP3-15347]](https://resources.bio-techne.com/images/products/Aspartate-Aminotransferase-Antibody-5J1B4-Western-Blot-NBP3-15347-img0002.jpg "Western Blot: Aspartate Aminotransferase Antibody (5J1B4) [NBP3-15347]")
Western Blot: Aspartate Aminotransferase Antibody (5J1B4) [NBP3-15347]
Western Blot: Aspartate Aminotransferase Antibody (5J1B4) [NBP3-15347] - Western blot analysis of extracts of various cell lines, using Aspartate Aminotransferase Rabbit mAb (NBP3-15347) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.![Western Blot: Aspartate Aminotransferase Antibody (5J1B4) [NBP3-15347]](https://resources.bio-techne.com/images/products/Aspartate-Aminotransferase-Antibody-5J1B4-Western-Blot-NBP3-15347-img0003.jpg "Western Blot: Aspartate Aminotransferase Antibody (5J1B4) [NBP3-15347]")
Western Blot: Aspartate Aminotransferase Antibody (5J1B4) [NBP3-15347]
Western Blot: Aspartate Aminotransferase Antibody (5J1B4) [NBP3-15347] - Western blot analysis of extracts of various cell lines, using Aspartate Aminotransferase Rabbit mAb (NBP3-15347) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunocytochemistry/ Immunofluorescence: Aspartate Aminotransferase Antibody (5J1B4) [NBP3-15347] -
Immunocytochemistry/ Immunofluorescence: Aspartate Aminotransferase Antibody (5J1B4) [NBP3-15347] - Confocal imaging of HeLa cells using Aspartate Aminotransferase Rabbit mAb . The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 60x.Applications for Aspartate Aminotransferase Antibody (5J1B4)
Application
Recommended Usage
ELISA
Recommended starting concentration is 1 μg/mL.
Immunocytochemistry/ Immunofluorescence
1:50 - 1:200
Western Blot
1:1000 - 1:6000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Aspartate Aminotransferase
Long Name
Glutamic-oxaloacetic transaminase 1
Alternate Names
aspartate aminotransferase, cytoplasmic, AST1, ASTQTL1, CASPAT, CCAT, Cysteine aminotransferase, cytoplasmic, Cysteine transaminase, cytoplasmic, EC 2.6.1.1, EC 2.6.1.3, GIG18, Glutamate oxaloacetate transaminase 1, glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1), GOT1, growth-inhibiting protein 18, SGOT, Transaminase A
Gene Symbol
GOT1
Additional Aspartate Aminotransferase Products
Product Documents for Aspartate Aminotransferase Antibody (5J1B4)
Product Specific Notices for Aspartate Aminotransferase Antibody (5J1B4)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...