Angiopoietin-like Protein 3/ANGPTL3 Antibody (4W9A7)
Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16596
Recombinant Monoclonal Antibody
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 4W9A7 expressed in HEK293
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Angiopoietin-like Protein 3/ANGPTL3 (Q9Y5C1). MFTIKLLLFIVPLVISSRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELR
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
Novus Biologicals Rabbit Angiopoietin-like Protein 3/ANGPTL3 Antibody (4W9A7) (NBP3-16596) is a recombinant monoclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
Scientific Data Images for Angiopoietin-like Protein 3/ANGPTL3 Antibody (4W9A7)
Immunohistochemistry-Paraffin: Angiopoietin-like Protein 3/ANGPTL3 Antibody (4W9A7) [NBP3-16596]
Immunohistochemistry-Paraffin: Angiopoietin-like Protein 3/ANGPTL3 Antibody (4W9A7) [NBP3-16596] - Immunohistochemistry of paraffin-embedded mouse kidney using Angiopoietin-like Protein 3/ANGPTL3 Rabbit mAb (NBP3-16596) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.Immunohistochemistry-Paraffin: Angiopoietin-like Protein 3/ANGPTL3 Antibody (4W9A7) [NBP3-16596] -
Immunohistochemistry-Paraffin: Angiopoietin-like Protein 3/ANGPTL3 Antibody (4W9A7) [NBP3-16596] - Confocal imaging of paraffin-embedded Rat liver using ANGPTL3 Rabbit mAb (dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.Immunohistochemistry-Paraffin: Angiopoietin-like Protein 3/ANGPTL3 Antibody (4W9A7) [NBP3-16596] -
Immunohistochemistry-Paraffin: Angiopoietin-like Protein 3/ANGPTL3 Antibody (4W9A7) [NBP3-16596] - Confocal imaging of paraffin-embedded Mouse liver using ANGPTL3 Rabbit mAb (dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.Applications for Angiopoietin-like Protein 3/ANGPTL3 Antibody (4W9A7)
Application
Recommended Usage
ELISA
Recommended starting concentration is 1 ug/mL
Immunocytochemistry/ Immunofluorescence
1:200 - 1:800
Immunohistochemistry
1:100 - 1:1000
Immunohistochemistry-Paraffin
1:100 - 1:1000
Western Blot
1:1000 - 1:2000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Angiopoietin-like Protein 3/ANGPTL3
Alternate Names
AGNPT5, Ang-5, Angiopoietin-5, ANGPTL3
Gene Symbol
ANGPTL3
Additional Angiopoietin-like Protein 3/ANGPTL3 Products
- All Products for Angiopoietin-like Protein 3/ANGPTL3
- Angiopoietin-like Protein 3/ANGPTL3 cDNA Clones
- Angiopoietin-like Protein 3/ANGPTL3 ELISA Kits
- Angiopoietin-like Protein 3/ANGPTL3 Lysates
- Angiopoietin-like Protein 3/ANGPTL3 Primary Antibodies
- Angiopoietin-like Protein 3/ANGPTL3 Proteins and Enzymes
- Angiopoietin-like Protein 3/ANGPTL3 Simple Plex
Product Documents for Angiopoietin-like Protein 3/ANGPTL3 Antibody (4W9A7)
Product Specific Notices for Angiopoietin-like Protein 3/ANGPTL3 Antibody (4W9A7)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...