Skip to main content

Aconitase 1 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP1-87677

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-87677
NBP1-87677-25ul

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human, Mouse, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for Aconitase 1 Antibody

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: YERIHRSNLVGMGVIPLEYLPGENADALGLTGQERYTIIIPENLKPQMKVQVKLDTGKTFQAVMRFDTDVELTYFLNGGILNYMIRKMAK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Aconitase 1 Antibody

Aconitase 1 Antibody

Immunohistochemistry-Paraffin: Aconitase 1 Antibody [NBP1-87677] -

Immunohistochemistry-Paraffin: Aconitase 1 Antibody [NBP1-87677] -Analysis in human kidney and skeletal muscle tissues using NBP1-87677 antibody. Corresponding ACO1 RNA-seq data are presented for the same tissues.
Western Blot: Aconitase 1 Antibody [NBP1-87677] - Analysis in human cell lines U2OS and SK-MEL-30. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.
Western Blot: Aconitase 1 Antibody [NBP1-87677] - Effect of HFD on IRP1. Densitometric analysis of IRP1 protein levels; beta-actin is shown as the loading control. Image collected and cropped by CiteAb from the following publication (https://dx.plos.org/10.1371/journal.pone.0116855), licensed under a CC-BY license.

Applications for Aconitase 1 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25 - 2 ug/mL

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04 - 0.4 ug/mL
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization, Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Reviewed Applications

Read 2 reviews rated 2.5 using NBP1-87677 in the following applications:

Published Applications

Read 3 publications using NBP1-87677 in the following applications:

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2), 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Aconitase 1

Aconitase 1, also known as iron regulatory element binding protein 1 (IREB1), is a cytosolic protein which binds to iron-responsive elements (IREs). IREs are stem-loop structures found in the 5' UTR of ferritin mRNA, and in the 3' UTR of transferrin receptor mRNA. The iron-induced binding to the IRE results in repression of translation of ferritin mRNA, and inhibition of degradation of the otherwise rapidly degrading transferrin receptor mRNA. Thus, IREB1 plays a central role in cellular iron homeostasis. It was also shown to have aconitase activity, and hence grouped with the aconitase family of enzymes.

Alternate Names

Aconitase, aconitase 1, soluble, aconitate hydratase, Citrate hydro-lyase, cytoplasmic aconitate hydratase, EC 4.2.1, EC 4.2.1.3, Ferritin repressor protein, IREB1IREBP1, IREBP, IRE-BP 1, Iron regulatory protein 1, iron-responsive element binding protein 1, Iron-responsive element-binding protein 1, IRP1ACONS

Gene Symbol

ACO1

Additional Aconitase 1 Products

Product Documents for Aconitase 1 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Aconitase 1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...