Skip to main content

Aconitase 1 Antibody (2C1), Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # H00000048-M01

Catalog #
Availability
Size / Price
Qty
Loading...
H00000048-M01

Key Product Details

Species Reactivity

Validated:

Human, Rat

Applications

ELISA, Immunoprecipitation, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 2C1

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for Aconitase 1 Antibody (2C1)

Immunogen

ACO1 (AAH18103, 780 a.a. ~ 889 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RDWAAKGPFLLGIKAVLAESYERIHRSNLVGMGVIPLEYLPGENADALGLTGQERYTIIIPENLKPQMKVQVKLDTGKTFQAVMRFDTDVELTYFLNGGILNYMIRKMAK

Localization

Cytoplasmic

Specificity

ACO1 - aconitase 1, soluble

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for Aconitase 1 Antibody (2C1)

Immunoprecipitation: Aconitase 1 Antibody (2C1) [H00000048-M01] - Analysis of ACO1 transfected lysate using anti-ACO1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ACO1 MaxPab rabbit polyclonal antibody.
ELISA: Aconitase 1 Antibody (2C1) [H00000048-M01] - Detection limit for recombinant GST tagged ACO1 is approximately 0.3ng/ml as a capture antibody.

Applications for Aconitase 1 Antibody (2C1)

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: Aconitase 1

Aconitase 1, also known as iron regulatory element binding protein 1 (IREB1), is a cytosolic protein which binds to iron-responsive elements (IREs). IREs are stem-loop structures found in the 5' UTR of ferritin mRNA, and in the 3' UTR of transferrin receptor mRNA. The iron-induced binding to the IRE results in repression of translation of ferritin mRNA, and inhibition of degradation of the otherwise rapidly degrading transferrin receptor mRNA. Thus, IREB1 plays a central role in cellular iron homeostasis. It was also shown to have aconitase activity, and hence grouped with the aconitase family of enzymes.

Alternate Names

Aconitase, aconitase 1, soluble, aconitate hydratase, Citrate hydro-lyase, cytoplasmic aconitate hydratase, EC 4.2.1, EC 4.2.1.3, Ferritin repressor protein, IREB1IREBP1, IREBP, IRE-BP 1, Iron regulatory protein 1, iron-responsive element binding protein 1, Iron-responsive element-binding protein 1, IRP1ACONS

Entrez Gene IDs

48 (Human)

Gene Symbol

ACO1

OMIM

100880 (Human)

Additional Aconitase 1 Products

Product Documents for Aconitase 1 Antibody (2C1)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Aconitase 1 Antibody (2C1)

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...