Skip to main content

Acetyl Coenzyme A Carboxylase Beta Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP1-90274

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-90274
NBP1-90274-25ul

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for Acetyl Coenzyme A Carboxylase Beta Antibody

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: ITKSKSEANLIPSQEPFPASDNSGETPQRNGEGHTLPKTPSQAEPASHKGPKDAGRRRNSLPPSHQKPPRNPLSSSDAAPSPELQANGTGTQGLEATDTNGLSSSARPQGQQAGSPSKEDKKQANIKRQLMTNFILGSFDDYSS

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23460794)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Acetyl Coenzyme A Carboxylase Beta Antibody

Immunohistochemistry-Paraffin: Acetyl Coenzyme A Carboxylase Beta Antibody [NBP1-90274] - Staining in human adipose tissue and cerebral cortex tissues using NBP1-90274 antibody. Corresponding ACACB RNA-seq data are presented for the same tissues.
Western Blot: Acetyl Coenzyme A Carboxylase Beta Antibody [NBP1-90274] - Analysis in human adipose tissue .
Immunohistochemistry-Paraffin: Acetyl Coenzyme A Carboxylase Beta Antibody [NBP1-90274] - Staining of human adipose tissue shows moderate cytoplasmic positivity in adipocytes.

Applications for Acetyl Coenzyme A Carboxylase Beta Antibody

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Published Applications

Read 1 publication using NBP1-90274 in the following applications:

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Acetyl Coenzyme A Carboxylase Beta

"Acetyl-CoA carboxylase (ACC) is a complex multifunctional enzyme system. ACC is a biotin-containing enzyme which

Alternate Names

ACC2ACC-beta, ACCBacetyl-CoA carboxylase 2, acetyl-CoA carboxylase beta, acetyl-Coenzyme A carboxylase beta, EC 6.4.1.2, HACC275

Entrez Gene IDs

32 (Human)

Gene Symbol

ACACB

UniProt

Additional Acetyl Coenzyme A Carboxylase Beta Products

Product Documents for Acetyl Coenzyme A Carboxylase Beta Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Acetyl Coenzyme A Carboxylase Beta Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...