Skip to main content

AC1 Antibody (3F12), Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # H00010141-M01

Catalog #
Availability
Size / Price
Qty
Loading...
H00010141-M01

Key Product Details

Species Reactivity

Validated:

Human

Applications

ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2b Kappa Clone # 3F12

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for AC1 Antibody (3F12)

Immunogen

C4orf6 (NP_005741, 1 a.a. ~ 93 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDTQKQIHKTHNSKNQFFTIFFFLSVEFGKEGTRKNFYLLLSIGHYGRKSRRADLGTADTADKTEPECFAASWTFDPNPSVTVSGAHSTAVHQ

Reactivity Notes

Human. Other species not tested.

Specificity

C4orf6 - chromosome 4 open reading frame 6

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2b Kappa

Applications for AC1 Antibody (3F12)

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Antibody reactive against recombinant protein on ELISA.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: AC1

This gene is expressed in neuroblastoma; however, the function of this gene is not yet determined.

Alternate Names

aC1, chromosome 4 open reading frame 6, expressed in neuroblastoma, Protein AC1

Entrez Gene IDs

10141 (Human)

Gene Symbol

C4ORF6

Additional AC1 Products

Product Documents for AC1 Antibody (3F12)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for AC1 Antibody (3F12)

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...