Skip to main content

ABCC11 Antibody (4H6), Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # H00085320-M02

Catalog #
Availability
Size / Price
Qty
Loading...
H00085320-M02

Key Product Details

Species Reactivity

Validated:

Human

Applications

ELISA, Flow Cytometry, Immunocytochemistry/ Immunofluorescence, Sandwich ELISA, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 4H6

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for ABCC11 Antibody (4H6)

Immunogen

ABCC11 (NP_115972.2, 433 a.a. ~ 532 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FVPIAVKGLTNSKSAVMRFKKFFLQESPVFYVQTLQDPSKALVFEEATLSWQQTCPGIVNGALELERNGHASEGMTRPRDALGPEEEGNSLGPELHKINL

Specificity

ABCC11 - ATP-binding cassette, sub-family C (CFTR/MRP), member 11 (4H6)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for ABCC11 Antibody (4H6)

Immunocytochemistry/Immunofluorescence: ABCC11 Antibody (4H6) [H00085320-M02] - Analysis of monoclonal antibody to ABCC11 on HeLa cell . Antibody concentration 10 ug/ml.
Sandwich ELISA: ABCC11 Antibody (4H6) [H00085320-M02] - Detection limit for recombinant GST tagged ABCC11 is 0.1 ng/ml as a capture antibody.

Applications for ABCC11 Antibody (4H6)

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: ABCC11

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This ABC full transporter is a member of the MRP subfamily which is involved in multi-drug resistance. The product of this gene participates in physiological processes involving bile acids, conjugated steroids, and cyclic nucleotides. In addition, a SNP in this gene is responsible for determination of human earwax type. This gene and family member ABCC12 are determined to be derived by duplication and are both localized to chromosome 16q12.1. Multiple alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Jul 2008]

Alternate Names

ATP-binding cassette protein C11, ATP-binding cassette transporter MRP8, ATP-binding cassette transporter sub-family C member 11, ATP-binding cassette, sub-family C (CFTR/MRP), member 11, EWWD, MRP8ATP-binding cassette sub-family C member 11, Multidrug resistance-associated protein 8, multi-resistance protein 8, WW

Entrez Gene IDs

85320 (Human)

Gene Symbol

ABCC11

Additional ABCC11 Products

Product Documents for ABCC11 Antibody (4H6)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ABCC11 Antibody (4H6)

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...
Loading...