Skip to main content

ABCA6 Antibody (2F1), Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # H00023460-M01

Catalog #
Availability
Size / Price
Qty
Loading...
H00023460-M01

Key Product Details

Species Reactivity

Validated:

Human

Applications

ELISA, Sandwich ELISA, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 2F1

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for ABCA6 Antibody (2F1)

Immunogen

ABCA6 (NP_525023, 53 a.a. ~ 149 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NVQFPGMAPQNLGRVDKFNSSSLMVVYTPISNLTQQIMNKTALAPLLKGTSVIGAPNKTHMDEILLENLPYAMGIIFNETFSYKLIFFQGYNSPLWK

Specificity

ABCA6 - ATP-binding cassette, sub-family A (ABC1), member 6 (2F1)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Scientific Data Images for ABCA6 Antibody (2F1)

Sandwich ELISA: ABCA6 Antibody (2F1) [H00023460-M01] - Detection limit for recombinant GST tagged ABCA6 is 3 ng/ml as a capture antibody.

Applications for ABCA6 Antibody (2F1)

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: ABCA6

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). This encoded protein is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. This gene is clustered among 4 other ABC1 family members on 17q24 and may play a role in macrophage lipid homeostasis. [provided by RefSeq]

Alternate Names

ABC transporter ABCA6, ATP-binding cassette A6, ATP-binding cassette sub-family A member 6, ATP-binding cassette, sub-family A (ABC1), member 6, EC 2.5.1.19, EC 3.6.3, EC 3.6.3.25, EST155051, FLJ43498

Entrez Gene IDs

23460 (Human)

Gene Symbol

ABCA6

Additional ABCA6 Products

Product Documents for ABCA6 Antibody (2F1)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ABCA6 Antibody (2F1)

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...