Skip to main content

15-Lipoxygenase 2 Antibody (4A7), Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # H00000247-M05

Catalog #
Availability
Size / Price
Qty
Loading...
H00000247-M05

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human

Applications

ELISA, Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 4A7

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for 15-Lipoxygenase 2 Antibody (4A7)

Immunogen

ALOX15B (AAH35217.1, 181 a.a. ~ 280 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NANFYLQAGSAFAEMKIKGLLDRKGLWRSLNEMKRIFNFRRTPAAEHAFEHWQEDAFFASQFLNGLNPVLIRRCHYLPKNFPVTDAMVASVLGPGTSLQA

Specificity

ALOX15B - arachidonate 15-lipoxygenase, type B (4A7)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for 15-Lipoxygenase 2 Antibody (4A7)

Immunocytochemistry/Immunofluorescence: 15-Lipoxygenase 2 Antibody (4A7) [H00000247-M05] - Analysis of monoclonal antibody to ALOX15B on HeLa cell. Antibody concentration 10 ug/ml
ELISA: 15-Lipoxygenase 2 Antibody (4A7) [H00000247-M05] - Detection limit for recombinant GST tagged ALOX15B is approximately 10ng/ml as a capture antibody.

Applications for 15-Lipoxygenase 2 Antibody (4A7)

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Published Applications

Read 1 publication using H00000247-M05 in the following applications:

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: 15-Lipoxygenase 2

This gene encodes a member of the lipoxygenase family of structurally related nonheme iron dioxygenases involved in the production of fatty acid hydroperoxides. The encoded protein converts arachidonic acid exclusively to 15S-hydroperoxyeicosatetraenoic acid, while metabolizing linoleic acid less effectively. This gene is located in a cluster of related genes and a pseudogene that spans approximately 100 kilobases on the short arm of chromosome 17. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq]

Alternate Names

15-lipoxygenase 2, 15-LOX-B, arachidonate 15-lipoxygenase 2, arachidonate 15-lipoxygenase B, Arachidonate 15-lipoxygenase type II, arachidonate 15-lipoxygenase, second type, arachidonate 15-lipoxygenase, type B, arachidonate omega(6) lipoxygenase, EC 1.13.11, EC 1.13.11.33,15-LOX-215S-lipoxygenase

Entrez Gene IDs

247 (Human)

Gene Symbol

ALOX15B

Additional 15-Lipoxygenase 2 Products

Product Documents for 15-Lipoxygenase 2 Antibody (4A7)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for 15-Lipoxygenase 2 Antibody (4A7)

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...