Skip to main content

14-3-3 gamma Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP2-54679

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-54679
NBP2-54679-25ul

Key Product Details

Species Reactivity

Validated:

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for 14-3-3 gamma Antibody

Immunogen

This antibody was developed against a Recombinant Protein corresponding to amino acids: EAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEIS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for 14-3-3 gamma Antibody

Western Blot: 14-3-3 gamma Antibody [NBP2-54679] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: 14-3-3 gamma Antibody [NBP2-54679] - Staining of human cerebral cortex shows cytoplasmic and nuclear positivity in neuronal cells.
Western Blot: 14-3-3 gamma Antibody [NBP2-54679] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Applications for 14-3-3 gamma Antibody

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: 14-3-3 gamma

14-3-3 protein gamma is a member of the 14-3-3 family of proteins which help mediate signal transduction. Specifically, 14-3-3 gamma is an adapter protein responsible for bringing signal transduction to completion. It therefore plays an important role in regulating many fundamental cellular processes, such as apoptosis and cell-cycle checkpoints.

Signal-induced phosphorylation has the ability to change protein function, however phosphorylation is not always enough to change a protein's function. 14-3-3 gamma has the ability to bind a large number of target proteins thereby affecting the proteins' activity and/or function.

14-3-3 gamma is highly expressed in brain, heart and skeletal muscle, where it is induced by growth factors in human vascular smooth muscle cells. This suggests that 14-3-3 gamma may play a role in muscle tissue function.

Alternate Names

1433 gamma, YWHAG

Gene Symbol

YWHAG

Additional 14-3-3 gamma Products

Product Documents for 14-3-3 gamma Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for 14-3-3 gamma Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...