RVG29-Cys

Name: RVG29-Cys
Brand: Tocris Bioscience
SKU: 8903

Tocris Bioscience, part of Bio-Techne | Catalog # 8903

COA / SDS

Nicotinic acetylcholine receptor targeting peptide for neuronal delivery

Key Product Details

Description:	Nicotinic acetylcholine receptor targeting peptide for neuronal delivery
Purity:	≥95% (HPLC)
Molecular Weight:	3369.79

View Full Technical Details for RVG29-Cys

Technical Data
Citations

Biological Activity for RVG29-Cys

RVG29-Cys is a peptide derived from rabies virus glycoprotein (RVG) able to specifically bind on the nicotinic acetylcholine receptors (nAchR) present on neuronal cells. RVG29-Cys can be used to functionalize LNPs via thiol-maleimide click chemistry for targeting nAchR present on blood-brain barrier (BBB). mRNA LNPs functionalized with RVG29-Cys shows improved transfection efficiency in cultured brain endothelial and neuronal cells, and in vivo, after systemic administration in mice.

Technical Data for RVG29-Cys

M. Wt	3369.79
Formula	C₁₄₄H₂₂₂N₄₄O₄₄S₃
Single Letter Sequence	YTIWMPENPRPGTPCDIFTNSRGKRASNGC
Storage	Store at -20°C
Purity	≥95% (HPLC)
CAS Number	1404289-25-3
PubChem ID	172898615
InChi Key	SQWGWNJDPJYWQQ-FMHCIDBQSA-N
Smiles	O=C(N[C@@H]([C@H](O)C)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](CC1=CNC2=CC=CC=C12)C(N[C@@H](CCSC)C(N3[C@@H](CCC3)C(N[C@@H](CCC(O)=O)C(N[C@@H](CC(N)=O)C(N4[C@@H](CCC4)C(N[C@@H](CCCNC(N)=N)C(N5[C@@H](CCC5)C(NCC(N[C@@H]([C@H](O)C)C(N6[C@@H](CCC6)C(N[C@@H](CS)C(N[C@@H](CC(O)=O)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](CC7=CC=CC=C7)C(N[C@@H]([C@H](O)C)C(N[C@@H](CC(N)=O)C(N[C@@H](CO)C(N[C@@H](CCCNC(N)=N)C(NCC(N[C@@H](CCCCN)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](C)C(N[C@@H](CO)C(N[C@@H](CC(N)=O)C(NCC(N[C@@H](CS)C(O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)[C@H](CC8=CC=C(C=C8)O)N

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility for RVG29-Cys

Solubility

Soluble to 1mg/ml in water

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Dilution Calculator

Calculate the dilution required to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

References for RVG29-Cys

References are publications that support the biological activity of the product.

Liu Brain-targeting gene delivery and cellular internalization mechanisms for modified rabies virus glycoprotein RVG29 nanoparticles. Biomaterials 2009 PMID: 19467700
Han Peptide-functionalized lipid nanoparticles for targeted systemic mRNA delivery to the brain. Nano Lett. 2025 PMID: 39688915