ProTx II

Name: ProTx II
Brand: Tocris Bioscience
SKU: 4023

Tocris Bioscience, part of Bio-Techne | Catalog # 4023

Citations (25)

COA / SDS

Selective NaV1.7 channel blocker

Key Product Details

Description:	Selective Na_V1.7 channel blocker
Purity:	≥95% (HPLC)
Molecular Weight:	3826.59

View Full Technical Details for ProTx II

Technical Data
Citations

Biological Activity for ProTx II

ProTx II is a selective Na_V1.7 channel blocker. Shifts activation gating positively and decreases current magnitude. Displays 100-fold selectivity over other sodium channel subtypes.

Technical Data for ProTx II

M. Wt	3826.59
Formula	C₁₆₈H₂₅₀N₄₆O₄₁S₈
Single Letter Sequence	YCQKWMWTCDSERKCCEGMVCRLWCKKKLW (Modifications: Disulfide bridges: 2-16, 9-21, 15-25)
Storage	Store at -20°C
Purity	≥95% (HPLC)
CAS Number	484598-36-9
PubChem ID	118708662
InChi Key	XOAUGYVLRSCGBG-ZJDFQAAZSA-N
Smiles	[H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@H](CC4=CNC5=C4C=CC=C5)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CSSC[C@H](NC(=O)[C@@H](NC(=O)[C@H](CC4=CNC5=C4C=CC=C5)NC(=O)[C@H](CCSC)NC(=O)[C@H](CC4=CNC5=C4C=CC=C5)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(N)=O)NC1=O)[C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N3)NC(=O)[C@@H](NC(=O)[C@H](CCSC)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC2=O)C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility for ProTx II

Solubility

Soluble to 1mg/ml in water

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Dilution Calculator

Calculate the dilution required to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

References for ProTx II

References are publications that support the biological activity of the product.

Xu Structural basis of Na_v1.7 inhibition by a gating-modifier spider toxin. Cell. 2019 PMID: 30661758
Edgerton Evidence for multiple effects of ProTxII on activation gating in Na_V 1.5. Toxicon. 2008 PMID: 18657562
Schmalhofer ProTx-II, a selective inhibitor of Na_V 1.7 sodium channels, blocks action potential propagation in nociceptors. Mol.Pharmacol. 2008 PMID: 18728100
Smith Molecular interactions of the gating modifier toxin ProTx-II with Na_V 1.5: implied existence of a novel toxin binding site coupled to activation. J.Biol.Chem. 2007 PMID: 17339321