Pramlintide

Name: Pramlintide
Brand: Tocris Bioscience
SKU: 5031

Tocris Bioscience, part of Bio-Techne | Catalog # 5031

Citations (2)

COA / SDS

Synthetic version of amylin (Cat. No. 3418)

Key Product Details

Description:	Synthetic version of amylin (Cat. No. 3418)
Purity:	≥95% (HPLC)
Molecular Weight:	3949.42

View Full Technical Details for Pramlintide

Technical Data
Citations

Biological Activity for Pramlintide

Pramlintide is a synthetic version of amylin (Cat. No. 3418). Exhibits high affinity for amylin, CGRP and calcitonin receptors (K_i values are 0.023, 3.8 and 5.1 nM respectively). Reduces postprandial hyperglycemia; also inhibits gastric emptying.

Technical Data for Pramlintide

M. Wt	3949.42
Formula	C₁₇₁H₂₆₇N₅₁O₅₃S₂
Single Letter Sequence	KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY (Modifications: Tyr-37 = C-terminal amide, Disulfide bridge: 2-7)
Storage	Store at -20°C
Purity	≥95% (HPLC)
CAS Number	151126-32-8
PubChem ID	70691388
InChi Key	TZIRZGBAFTZREM-MKAGXXMWSA-N
Smiles	[H]N[C@@H](CCCCN)C(=O)N[C@H]1CSSC[C@H](NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC1=O)[C@@H](C)O)[C@@H](C)O)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility for Pramlintide

Solubility

Soluble to 1mg/ml in water

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Dilution Calculator

Calculate the dilution required to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

References for Pramlintide

References are publications that support the biological activity of the product.

Hoogwerf Pramlintide, the synthetic analogue of amylin: phsyiology, pathophysiology, and effects on glycemic control, body weight, and selected biomarkers of vascular risk. Vasc.Health Risk Manag. 2008 PMID: 18561511
Young Preclinical pharmacology of pramli. in the rat: comparisons with human and rat amylin. Drug Dev.Res.