Iberiotoxin

Name: Iberiotoxin
Brand: Tocris Bioscience
SKU: 1086
Rating: 5 (1 reviews)

Catalog # 1086

Citations (15)

(1)

COA / SDS

Order Information

Bio-Techne Corporation

tel: (800) 343-7475 (free phone)

tel: (612) 379-2956

customercare.na@bio-techne.com

Shipping Information

$35 to United States

Products in stock will be shipped in 1-3 business days unless specified.

View Distributors

Key Product Details

Description:	K_Ca (BK) channel blocker
Purity:	≥95% (HPLC)
Molecular Weight:	4230

View Full Technical Details for Iberiotoxin

Biological Activity

Iberiotoxin is a selective blocker of the big conductance Ca²⁺-activated K⁺ channel.

Technical Data

M. Wt	4230
Formula	C₁₇₉H₂₇₄N₅₀O₅₅S₇
Single Letter Sequence	XFTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ (Modifications: X-1 = pGlu, Disulfide bridges: 7-28, 13-33, 17-35)
Storage	Store at -20°C
Purity	≥95% (HPLC)
CAS Number	129203-60-7
PubChem ID	16132435
InChi Key	VDNVVLOBNHIMQA-UHFFFAOYSA-N
Smiles	[H]N1[C@@H](CCC1=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CC3=CC=CC=C3)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CO)NC1=O)C(C)C)C(=O)N[C@@H](CC1=CNC4=C1C=CC=C4)C(=O)N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(=O)N3)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](CCSC)NC2=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCC(N)=O)C(O)=O)C(C)C

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility

Soluble to 0.7mg/ml in water

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Dilution Calculator

Calculate the dilution required to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

References

References are publications that support the biological activity of the product.

Suarez-Kurtz Effects of charybdotoxin and iberiotoxin on the spontaneous motility and tonus of different guinea-pig smooth muscle tissues. J.Pharmacol.Exp.Ther. 1991 PMID: 1717682
Galvez Purification and characterization of a unique, potent, peptidyl probe for the high conductance calcium-activated potassium channel from venom of the scorpion Buthus tamulus. J.Biol.Chem. 1990 PMID: 1694175

Citations for Iberiotoxin (15)

Showing 1 - 10 of 15 citations Showing All

View all citations for the Small Molecules and Peptides platform.

Search Title:

Citations are publications that use Bio-Techne products. Selected citations for Iberiotoxin include:

Hirono et al. (2015) BK Channels Localize to the Paranodal Junction and Regulate Action Potentials in Myelinated Axons of Cerebellar Purkinje Cells. Am J Physiol Cell Physiol. 35:7082
PMID: 25948259
Lai et al. (2014) BK channels regulate sinoatrial node firing rate and cardiac pacing in vivo. Am J Physiol Heart Circ Physiol. 307:H1327
PMID: 25172903
Needham et al. (2014) The role of K+ and Cl- channels in the regulation of retinal arteriolar tone and blood flow. FASEB J. 55:2157
PMID: 24609622
Shukla et al. (2014) Maternal nutrient restriction during pregnancy impairs an endothelium-derived hyperpolarizing factor-like pathway in sheep fetal coronary arteries. Am J Physiol Heart Circ Physiol. 307:H134
PMID: 24816259
Ok et al. (2014) Bupivacaine-induced Vasodilation Is Mediated by Decreased Calcium Sensitization in Isolated Endothelium-denuded Rat Aortas Precontracted with Phenylephrine. Korean J Pain. 27:229
PMID: 25031808
Mannowetz et al. (2013) Slo1 is the principal potassium channel of human spermatozoa. Elife (Cambridge). 2:e01009
PMID: 24137539
Grassin-Delyle et al. (2013) The expression and relaxant effect of bitter taste receptors in human bronchi. Respir Res. 14:134
PMID: 24266887
Kyle et al. (2013) Mechanisms underlying activation of transient BK current in rabbit urethral smooth muscle cells and its modulation by IP3-generating agonists. Invest Ophthalmol Vis Sci. 305:C609
PMID: 23804200
Wan et al. (2013) Reduced vascular smooth muscle BK channel current underlies heart failure-induced vasoconstriction in mice. Mol Pain. 27:1859
PMID: 23325318
Townsend and Emala (2013) Quercetin acutely relaxes airway smooth muscle and potentiates β-agonist-induced relaxation via dual phosphodiesterase inhibition of PLCβ and PDE4. Am J Physiol Lung Cell Mol Physiol. 305:L396
PMID: 23873842
Pulkkinen et al. (2012) The bitter taste receptor (TAS2R) agonists denatonium and chloroquine display distinct patterns of relaxation of the guinea pig trachea. Am J Physiol Lung Cell Mol Physiol. 303:L956
PMID: 22962016
Benvindo et al. (2011) Relaxant effect and possible mechanism of 17-nor-subincanadine E in rabbit corpora cavernosa. Asian J Androl. 13:747
PMID: 21765439
Zemkova et al. (2011) NE causes a biphasic change in mammalian pinealocye membrane potential: role of alpha1B-adrenoreceptors, phospholipase C, and Ca²⁺. Endocrinology. 152:3842
PMID: 21828176
Lee et al. (2011) Role of perivascular adipose tissue-derived methyl palmitate in vascular tone regulation and pathogenesis of hypertension. Circulation. 124:1160
PMID: 21844078
Tahvildari et al. (2008) Ionic basis of ON and OFF persistent activity in layer III lateral entorhinal cortical principal neurons. J Neurophysiol. 99:2006
PMID: 18256167

There are no citations that match your criteria.

Showing 1 - 10 of 15 citations Showing All

Customer Reviews (1)

5 out of 5

1 customer rating

5 stars

100%

4 stars

3 stars

2 stars

1 star

Customer Images

Showing 1 - 1 of 1 review Showing All

Filter By:

Selective blocker worked ideally to block Calcium channels

Name: Farzana Islam

Species: Human

Assay Type: In Vitro

Cell Line/Tissue: HEK 293

High-affinity and specific KCa1.1 channel blocker, used to study how it works to block SK channels. The product dissolved in aqueous buffer and was excellent in the lab conditions. Inhibition of SK channels were observed.

There are no reviews that match your criteria.