Glucagon-like peptide 1 (1-37) (human, rat)

Name: Glucagon-like peptide 1 (1-37) (human, rat)
Brand: Tocris Bioscience
SKU: 1851

Tocris Bioscience, part of Bio-Techne | Catalog # 1851

Citations (3)

COA / SDS

Endogenous pancreatic peptide

Key Product Details

Description:	Endogenous pancreatic peptide
Alternative Names:	GLP-1 (1-37) amide
Purity:	≥95% (HPLC)
Molecular Weight:	4169.52

View Full Technical Details for Glucagon-like peptide 1 (1-37) (human, rat)

Technical Data
Citations

Biological Activity for Glucagon-like peptide 1 (1-37) (human, rat)

Glucagon-like peptide 1 (1-37) (human, rat) is a pancreatic hormone synthesized by post-translational processing of proglucagon. Unlike truncated forms of GLP-1, it has no effect on food intake in rats and does not enhance pancreatic insulin secretion. However it induces insulin expression in intestinal epithelial cells, which can restore glucose homeostasis when implanted into diabetic mice.

Technical Data for Glucagon-like peptide 1 (1-37) (human, rat)

M. Wt	4169.52
Formula	C₁₈₆H₂₇₅N₅₁O₅₉
Single Letter Sequence	HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Storage	Store at -20°C
Purity	≥95% (HPLC)
CAS Number	87805-34-3
PubChem ID	16131070
InChi Key	UKVFVQPAANCXIL-FJVFSOETSA-N
Smiles	[H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility for Glucagon-like peptide 1 (1-37) (human, rat)

Solubility

Soluble to 5mg/ml in water

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Dilution Calculator

Calculate the dilution required to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

References for Glucagon-like peptide 1 (1-37) (human, rat)

References are publications that support the biological activity of the product.

Navarro Colocalization of glucagon-like peptide-1 (GLP-1) receptors, glucose transporter GLUT-2, and glucokinase mRNAs in rat hypothalamic cells: evidence for a role of GLP-1 receptor agonists as an inhibitory signal for food and water intake. J.Neurochem. 1996 PMID: 8863504
Suzuki Glucagon-like peptide 1 (1-37) converts intestinal epithelial cells into Ins-producing cells. Proc.Natl.Acad.Sci.USA
Bell Exon duplication and divergence in the human preproglucagon gene. Nature 1983 PMID: 6877358