GIP (human)

Name: GIP (human)
Brand: Tocris Bioscience
SKU: 2084

Tocris Bioscience, part of Bio-Techne | Catalog # 2084

Citations (9)

COA / SDS

Potent insulinotropic gut hormone; GIP agonist

Key Product Details

Description:	Potent insulinotropic gut hormone; GIP agonist
Alternative Names:	Gastric Inhibitory Polypeptide (human)
Purity:	≥95% (HPLC)
Molecular Weight:	4983.58

View Full Technical Details for GIP (human)

Technical Data
Citations

Biological Activity for GIP (human)

GIP (human) is a potent insulinotropic hormone synthesized by duodenal K-cells. High affinity GIP receptor agonist (EC₅₀ = 0.81 nM) that inhibits gastric acid secretion and stimulates pancreatic insulin release in response to glucose. Also affects lipid metabolism and displays mitogenic and antiapoptotic effects in pancreatic β-cells.

Technical Data for GIP (human)

M. Wt	4983.58
Formula	C₂₂₆H₃₃₈N₆₀O₆₆S
Single Letter Sequence	YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
Storage	Store at -20°C
Purity	≥95% (HPLC)
CAS Number	100040-31-1
PubChem ID	16140499
InChi Key	MGXWVYUBJRZYPE-YUGYIWNOSA-N
Smiles	[H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(N)=O)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility for GIP (human)

Solubility

Soluble to 1mg/ml in water

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Dilution Calculator

Calculate the dilution required to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

References for GIP (human)

References are publications that support the biological activity of the product.

Trumper Glucose-dependent Insotropic polypeptide is a growth factor for β (INS-1) cells by pleiotropic signaling. Mol.Endocrinol.
Meier Gastric inhibitory polypeptide: the neglected incretin revisited. Regul.Peptides
Wheeler Functional expression of the rat pancreatic islet glucose-dependent Insotropic polypeptide receptor: ligand binding and intracellular signaling properties. Endocrinol.