ERK1 Inhibitor Peptide Set
Novus Biologicals, part of Bio-Techne | Catalog # NBP2-29333
Key Product Details
Species
Human, Mouse, Rat, Hamster, Rabbit, Xenopus
Product Specifications
Specificity
The ERK inhibitory peptide also contains a protein transduction (PTD) sequence (DRQIKIWFQNRRMKWKK) derived from antennapedia which renders the peptide cell permeable.
The control peptide consists of only the PTD sequence.
The control peptide consists of only the PTD sequence.
Application Notes
Inhibition of Erk activation.
The inhibitor peptide is to block ERK activation by MEK. Optimal peptide concentrations and incubation times vary between model systems and should be determined empirically by users. A 100 uM final concentration may be a useful starting point.
Please refer to Kalemen et al (2002) for additional information about how the inhibitor peptide has been used to block ERK activation by MEK.
The inhibitor peptide is to block ERK activation by MEK. Optimal peptide concentrations and incubation times vary between model systems and should be determined empirically by users. A 100 uM final concentration may be a useful starting point.
Please refer to Kalemen et al (2002) for additional information about how the inhibitor peptide has been used to block ERK activation by MEK.
Reactivity Notes
Broad; the peptide sequence is 100% conserved among multiple species.
Inhibitor Content
ERK Inhibitor peptide: 2 x 1 mg (lyophilized) DRQIKIWFQNRRMKWKKGMPKKKPTPIQLN (ERK inhibitor sequence: GMPKKKPTPIQLN). Molecular weight: 3795.
Antennapedia Control peptide: 2 x 1 mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361
Formulation, Preparation, and Storage
Preparation Method
Preparation of 5 mM Stock Solutions
PBS* is added directly to the vials to prepare the stock solutions. Note: Bring the solution to room temperature and quick spin the tubes before opening the caps.
ERK Inhibitor Peptide: 1 mg of DRQIKIWFQNRRMKWKKGMPKKKPTPIQLN
Add 53 ul of PBS* to the vial to make a 5 mM stock solution. Mix by vortexing. Aliquot and store at -20C or -80C. Avoid repeated freeze thawing.
Control Peptide: 1 mg of DRQIKIWFQNRRMKWKK
Add 84.8 ul PBS* to the vial. Mix by vortexing. Aliquot and store at 20C or -80C. Avoid repeated freeze thawing.
Recipe for 1X PBS:
1. Dissolve the following in 800ml distilled H2O.
-8g of NaCl
-0.2g of KCl
-1.44g of Na2HPO4
-0.24g of KH2PO4
2. Adjust pH to 7.5 with HCl.
3. Adjust volume to 1L with additional distilled H2O.
4. Sterilize by autoclaving.
Please contact technical support for detailed reconstitution instructions.
PBS* is added directly to the vials to prepare the stock solutions. Note: Bring the solution to room temperature and quick spin the tubes before opening the caps.
ERK Inhibitor Peptide: 1 mg of DRQIKIWFQNRRMKWKKGMPKKKPTPIQLN
Add 53 ul of PBS* to the vial to make a 5 mM stock solution. Mix by vortexing. Aliquot and store at -20C or -80C. Avoid repeated freeze thawing.
Control Peptide: 1 mg of DRQIKIWFQNRRMKWKK
Add 84.8 ul PBS* to the vial. Mix by vortexing. Aliquot and store at 20C or -80C. Avoid repeated freeze thawing.
Recipe for 1X PBS:
1. Dissolve the following in 800ml distilled H2O.
-8g of NaCl
-0.2g of KCl
-1.44g of Na2HPO4
-0.24g of KH2PO4
2. Adjust pH to 7.5 with HCl.
3. Adjust volume to 1L with additional distilled H2O.
4. Sterilize by autoclaving.
Please contact technical support for detailed reconstitution instructions.
Concentration
Lyoph
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Background: ERK1
Long Name
Extracellular Signal-regulated Kinase 1
Alternate Names
MAPK3, P44ERK1, p44mapk, PRKM3
Gene Symbol
MAPK3
Additional ERK1 Products
Product Documents for ERK1 Inhibitor Peptide Set
Product Specific Notices for ERK1 Inhibitor Peptide Set
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Inhibitors are guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...