Echistatin, α1 isoform

Name: Echistatin, α 1 isoform
Brand: Tocris Bioscience
SKU: 3202

Tocris Bioscience a Bio-Techne Brand

Catalog # 3202

Citations (2)

COA / SDS

Catalog #

Availability

Size / Price

Qty

Key Product Details

Description:	α_Vβ₃ and glycoprotein IIb/IIIa (integrin α_IIbβ₃) inhibitor
Purity:	≥95% (HPLC)
Molecular Weight:	5417.1

View Full Technical Details for Echistatin, α1 isoform

Biological Activity for Echistatin, α1 isoform

Echistatin, α1 isoform is a potent irreversible α_Vβ₃ integrin antagonist (K_i = 0.27 nM). Disrupts attachment of osteoclasts to bone and inhibits bone reabsorption (IC₅₀ = 0.1 nM). Prevents ADP-induced platelet aggregation via inhibition of glycoprotein IIb/IIIa (GpIIb/IIIa, α_IIbβ₃) receptors (IC₅₀ = 30 nM) in vitro.

Technical Data for Echistatin, α1 isoform

M. Wt	5417.1
Formula	C₂₁₇H₃₄₁N₇₁O₇₄S₉
Single Letter Sequence	ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT (Modifications: Disulfide bridges: 2-11, 7-32, 8-37, 20-39)
Storage	Store at -20°C
Purity	≥95% (HPLC)
CAS Number	154303-05-6
PubChem ID	90488810
InChi Key	KZMZKUVIDVBQGX-UHFFFAOYSA-N
Smiles	[H]N[C@@H](CCC(O)=O)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H]3CSSC[C@@H]4NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CSSC[C@H](NC(=O)[C@@H]5CCCN5C(=O)CNC(=O)[C@H](CO)NC(=O)[C@H](CCC(O)=O)NC1=O)C(=O)N3)NC(=O)[C@H](CC1=CC=C(O)C=C1)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CC(O)=O)NC4=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(N)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC1=CC=CC=C1)NC(=O)[C@H](CCCCN)NC2=O)[C@@H](C)O)[C@@H](C)CC)[C@@H](C)O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility for Echistatin, α1 isoform

Solubility

Soluble to 1mg/ml in water

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Dilution Calculator

Calculate the dilution required to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

References for Echistatin, α1 isoform

References are publications that support the biological activity of the product.

Kumar Biochemical characteriation of the binding of echistatin to integrin α_Vβ₃ receptor. J.Pharmacol.Exp.Ther. 1997 PMID: 9353406
Musial Inhibition of platelet adhesion to surfaces of extracorporeal circuits by disintegrins RGD-containing peptides from viper venoms. Circulation 1990 PMID: 2364514
Sato Echistatin is a potent inhibitor of bone resorption in culture. J.Cell.Biol. 1990 PMID: 2211834

Citations for Echistatin, α1 isoform (2)

Showing 1 - 2 of 2 citations Showing All

Search Title:

Citations are publications that use Bio-Techne products. Selected citations for Echistatin, α1 isoform include:

Lin et al. (2013) Angiopoietin-like 3 induces podocyte F-actin rearrangement through integrin α(V)β3/FAK/PI3K pathway-mediated Rac1 activation. PLoS One. 2013:135608
PMID: 24294595
Schrader et al. (2011) Matrix stiffness modulates proliferation, chemotherapeutic response, and dormancy in hepatocellular carcinoma cells. Biomed Res Int. 53:1192
PMID: 21442631

There are no citations that match your criteria.

Showing 1 - 2 of 2 citations Showing All

Product Documents for Echistatin, α1 isoform

COA

Certificate of Analysis

To download a Certificate of Analysis, please select a batch below.