Apelin-36 (human)

Name: Apelin-36 (human)
Brand: Tocris Bioscience
SKU: 2426

Catalog # 2426 | Tocris Bioscience a Bio-Techne Brand

COA / SDS

Endogenous apelin agonist

Key Product Details

Description:	Endogenous apelin agonist
Purity:	≥95% (HPLC)
Molecular Weight:	4195.87

View Full Technical Details for Apelin-36 (human)

Technical Data
Citations / Reviews

Biological Activity for Apelin-36 (human)

Apelin-36 (human) is an endogenous APJ receptor agonist (EC₅₀ = 20 nM) that is secreted by adipocytes. Binds with high affinity to human APJ receptors expressed in HEK 293 cells (pIC₅₀= 8.61). Involved in regulation of cardiovascular function, fluid homeostasis and feeding. Blocks entry of some HIV-1 and HIV-2 strains into NP-2/CD4 cells expressing APJ.

Technical Data for Apelin-36 (human)

M. Wt	4195.87
Formula	C₁₈₄H₂₉₇N₆₉O₄₃S
Single Letter Sequence	LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF
Storage	Store at -20°C
Purity	≥95% (HPLC)
CAS Number	252642-12-9
PubChem ID	25023576
InChi Key	IRSHPNNQNFBJMK-ZWVJBCNTSA-N
Smiles	[H]N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(=O)N1CCC[C@H]1C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CCC(N)=O)C(=O)NCC(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](CCSC)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility for Apelin-36 (human)

Solubility

Soluble to 1mg/ml in water

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Dilution Calculator

Calculate the dilution required to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

References for Apelin-36 (human)

References are publications that support the biological activity of the product.

Medhurst Pharmacological and immunohistochemical characterization of the APJ receptor and its endogenous ligand apelin. J.Neurochem. 2003 PMID: 12603839
Zou Apelin peptides block the entry of human immunodeficiency virus (HIV). FEBS Lett. 2000 PMID: 10802050
Tatemoto Isolation and characterization of a novel endogenous peptide ligand for the human APJ receptor. Biochem.Biophys.Res.Comm.

Citations for Apelin-36 (human)

Please visit our Instrument Citation Database to search our collection of scientific articles that feature our instruments.