ACTH (1-39)

Name: ACTH (1-39)
Brand: Tocris Bioscience
SKU: 3492

Tocris Bioscience, part of Bio-Techne | Catalog # 3492

Citations (6)

COA / SDS

Potent endogenous MC2 agonist

Key Product Details

Description:	Potent endogenous MC₂ agonist
Alternative Names:	Adrenocorticotropic hormone (1-39)
Purity:	≥95% (HPLC)
Molecular Weight:	4541.1

View Full Technical Details for ACTH (1-39)

Technical Data
Citations

Biological Activity for ACTH (1-39)

ACTH (1-39) is a potent endogenous melanocortin receptor 2 (MC₂) agonist (EC₅₀ = 57 pM). Component of the hypothalamic-pituitary-adrenal (HPA) axis that stimulates glucocorticoid production and release from the adrenal cortex. Induces insulin resistance, promotes a proinflammatory profile and stimulates UCP-1 in adipocytes in vitro.

Technical Data for ACTH (1-39)

M. Wt	4541.1
Formula	C₂₀₇H₃₀₈N₅₆O₅₈S
Single Letter Sequence	SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
Storage	Store at -20°C
Purity	≥95% (HPLC)
CAS Number	12279-41-3
PubChem ID	90488852
InChi Key	KNOZNCXWNQVSDB-LAZPIJHFSA-N
Smiles	[H]N[C@@H](CO)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(N)=O)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility for ACTH (1-39)

Solubility

Soluble to 1mg/ml in water

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Dilution Calculator

Calculate the dilution required to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

References for ACTH (1-39)

References are publications that support the biological activity of the product.

Iwen Melanocortin crosstalk with adipose functions: ACTH directly induces Ins resistance, promotes a pro-inflammatory adipokine profile and stimulates UCP-1 in adipocytes. J.Endocrinol. 2008 PMID: 18310442
Bertolini Brain effects of melanocortins. Pharmacol.Res. 2009 PMID: 18996199
Kapas Agonist and receptor binding properties of adrenocorticotropin peptides using the cloned mouse adrenocorticotropin receptor expressed in a stably transfected HeLa cell line. Endocrinology 1996 PMID: 8754753