Skip to main content

VPS36 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-13519PEP

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-13519PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human VPS36.

Source: E. coli

Amino Acid Sequence: KDKQGDITEDETIRFKSYLLSMGIANPVTRETYGSGTQYHMQLAKQLAGILQVPLEERGGIMSLTEVYCLVNRARGMELLSPEDLVNACK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13519.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-13519PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: VPS36

Component of the escrt-ii complex, which is required for multivesicular bodies (mvbs) formation and sorting of endosomal cargo proteins into mvbs. the mvb pathway mediates delivery of transmembrane proteins into the lumen of the lysosome for degradation. the escrt-ii complex is probably involved in the recruitment of the escrt-iii complex. its ability to bind ubiquitin probably plays a role in endosomal sorting of ubiquitinated cargo proteins by escrt complexes. the escrt-ii complex may also play a role in transcription regulation, possibly via its interaction with ell.

Alternate Names

C13orf9, CGI-145, DKFZp781E0871, Eap45, EAP45chromosome 13 open reading frame 9, ELL-associated protein of 45 kDa, ELL-associated protein, 45 kDa, ESCRT-II complex subunit VPS36, vacuolar protein sorting 36 homolog (S. cerevisiae), vacuolar protein sorting 36 homolog (yeast), vacuolar protein-sorting-associated protein 36

Gene Symbol

VPS36

Additional VPS36 Products

Product Documents for VPS36 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for VPS36 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...