Skip to main content

Ubiquitin C Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-54692PEP

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-54692PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Ubiquitin C

Source: E. coli

Amino Acid Sequence: MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-54692.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-54692PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Ubiquitin C

Ubiquitin is a small protein that is composed of 76 amino acids and its sequence is highly conserved throughout evolution from invertebrates to mammals. In the cytoplasm, ubiquitin is involved in ATP-dependent nonlysomal proteolysis of various proteins. In the nucleus, ubiquitin is conjugated to histone2A and may play a role in regulation of chromatin structure and/or regulation of transcriptional activity.Ubiquitin(76amino acid) was overexpressed in E.coli and purified by using conventional chromatography techniques.

Alternate Names

HMG20, PolyUbiquitin, polyubiquitin-B, Polyubiquitin-C, UBC, Ubiquitin-40S ribosomal protein S27a, ubiquitin-60S ribosomal protein L40

Gene Symbol

UBC

Additional Ubiquitin C Products

Product Documents for Ubiquitin C Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Ubiquitin C Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...