Skip to main content

TXNL1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-86900PEP

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-86900PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TXNL1.

Source: E. coli

Amino Acid Sequence: LLLQFQSQWRRGHPAGLSVRMVGVKPVGSDPDFQPELSGAGSRLAVVKFTMRGCGPCLRIAPAFSSMSNKYPQAVFLEVDVHQCQGTAATNNISATPTFLFFRNKVRIDQYQGADAVGLEEKIKQHLENDPGSNEDTDIPKG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86900.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-86900PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: TXNL1

Thioredoxins are a group of small redox active proteins which have a conserved active site sequence. The predicted 32.3-kD protein of TXNL1 (Thioredoxin like protein 1) has 2 distinct domains: an N terminal domain, which is 43% identical to human TXN, and a C terminal domain, which showed no homology to other proteins in the sequence databases. The active site sequence, located within the N terminal domain, is that of a thioredoxin like protein; compared to the active site sequence of TXN, it has a single amino acid substitution. Unlike other thioredoxin like proteins, TXNL1 did not act as a substrate for thioredoxin reductase in an insulin assay.

Alternate Names

32 kDa thioredoxin-related protein, thioredoxin-like 1, thioredoxin-like, 32kDa, thioredoxin-related 32 kDa protein, thioredoxin-related protein 1, TRP32thioredoxin-like protein 1, Txl, TXL-1, TXNL

Gene Symbol

TXNL1

Additional TXNL1 Products

Product Documents for TXNL1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for TXNL1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...