Skip to main content

TRIM72 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-86000PEP

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-86000PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TRIM72.

Source: E. coli

Amino Acid Sequence: LKTQLPQQKLQLQEACMRKEKSVAVLEHQLVEVEETVRQFRGAVGEQLGKMRVFLAALEGSLDREAERVRGE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86000.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-86000PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: TRIM72

Muscle-specific protein that plays a central role in cell membrane repair by nucleating the assembly of therepair machinery at injury sites. Specifically binds phosphatidylserine. Acts as a sensor of oxidation: upon membranedamage, entry of extracellular oxidative environment results in disulfide bond formation and homooligomerization atthe injury site. This oligomerization acts as a nucleation site for recruitment of TRIM72-containing vesicles to theinjury site, leading to membrane patch formation. Probably acts upstream of the Ca(2+)-dependent membrane resealingprocess. Required for transport of DYSF to sites of cell injury during repair patch formation. Regulates membranebudding and exocytosis. May be involved in the regulation of the mobility of KCNB1-containing endocytic vesicles (Bysimilarity)

Alternate Names

MG53Mg53, Mitsugumin-53, tripartite motif containing 72, tripartite motif-containing 72, tripartite motif-containing protein 72

Gene Symbol

TRIM72

Additional TRIM72 Products

Product Documents for TRIM72 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for TRIM72 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...