Skip to main content

THOC5 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-57331PEP

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-57331PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human THOC5.

Source: E. coli

Amino Acid Sequence: SDAEEEQTTKRRRPTLGVQLDDKRKEMLKRHPLSVMLDLKCKDDSVLHLTFYYLMNLNIMTVKAKVTTAMELITPISAGDLLSPDSVLSCLYPGDHGKKTPNPANQYQFDKVGILTLSDYVLELGHPYLWVQKLGG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57331.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-57331PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: THOC5

THOC5 is part of the splicesome complex. It has been identified as a target in macrophage-colony stimulating factor signaling and may have a potential role in leukemogenesis. Alternative names for THOC5 include THO complex subunit 5 homolog, NF2/meningioma region protein pK1.3, placental protein 39.2, C22orf19, and KIA

Alternate Names

C22orf19, chromosome 22 open reading frame 19, FMIP, Fms-interacting protein, fSAP79hTREX90, Functional spliceosome-associated protein 79, KIAA0983, NF2/meningioma region protein pK1.3, PK1.3, Placental protein 39.2, PP39.2, THO complex 5, THO complex subunit 5 homolog

Gene Symbol

THOC5

Additional THOC5 Products

Product Documents for THOC5 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for THOC5 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...