Skip to main content

TERT Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-56116PEP

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-56116PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TERT.

Source: E. coli

Amino Acid Sequence: GVLLKTHCPLRAAVTPAAGVCAREKPQGSVAAPEEEDTDPRRLVQLLRQHSSPWQVYGFVRACLRRLVPPGLWGSRHNERRFLRNTKKFISLGKHAKLS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56116.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-56116PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: TERT

Telomeres are nucleoprotein structures at the ends of eukaryotic chromosomes. Telomeres regulate several crucial cellular functions and participate in the control of complex phenotypes, such as aging and cancer. Cell immortalization is strongly associated with the stabilization of telomere length. Therefore, it is suggested that cancer cells achieve immortalization in part through illegitimate activation of telomerase expression. Telomerase reverse transcriptase (TERT) is the rate-limiting catalytic subunit of telomerase. Telomerase is a ribonucleoprotein composed of an internal telomerase RNA template (TERC) and the enzyme TERT. Telomerase is an enzyme uniquely associated with immortal cell lines and is useful for identifying undifferentiated PSCs.

Long Name

Telomerase Reverse Transcriptase

Alternate Names

EST2Telomerase-associated protein 2, hEST2, hTERT, TCS1EC 2.7.7.49, Telomerase catalytic subunit, telomerase reverse transcriptase, TP2HEST2, TRTEC 2.7.7

Gene Symbol

TERT

Additional TERT Products

Product Documents for TERT Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TERT Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...