Skip to main content

Tec Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-55192PEP

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-55192PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Tec.

Source: E. coli

Amino Acid Sequence: VKNDDGVIPCQNKYPFQVVHDANTLYIFAPSPQSRDLWVKKLKEEIKNNNNIMIKYHPKFWTDGSYQCCRQTEKLAPGCEKYNLFESSIRKALPPAPETKKRRPPPPIPLEEEDNSEEIVVAMYDFQAAEGHDLRLERGQEYLIL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55192.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-55192PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Tec

Tec is a member of the Tec family of non-receptor protein-tyrosine kinase (PTK) which also includes Btk, emtk/itk/Tsk, Rlk/Txx and Bmx (1). Tec is composed of a pleckstrin domain (PH), an SH3 and SH2 domain, a catalytic kinase domain and a Tec homology domain (TH) (2). Tec's TH domain interacts with the SH3 domain of Grb2, Src family PTKs (Fyn, Lyn, and Hck), Vav, and c-Kit. Tec is mostly expressed in hematopoietic cells. Tec's SH3 domain interacts with DC28 and has been shown to phosphorylate p62dok, CD28 substrate (3). Tec can phosphorylate Jak kinase in hematopoietic cells (4) and can also be phosphorylated by Src member Lyn on multiple tyrosine residues (5).

Long Name

Translocated in Extraskeletal Chondrosarcoma Protein Tyrosine Kinase

Alternate Names

PSCTK4

Gene Symbol

TEC

Additional Tec Products

Product Documents for Tec Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Tec Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...