Skip to main content

SRPRB Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-89035PEP

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-89035PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SRPRB.

Source: E. coli

Amino Acid Sequence: LCDSGKTLLFVRLLTGLYRDTQTSITDSCAVYRVNNNRGNSLTLIDLPGHESLRLQFLERFKSSARAIVFVVDSAAFQREVKDVAEFLYQVLIDSMGLKNTPSFLIACNKQDIAMAKSAKLIQQQLEKELNTL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89035.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-89035PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: SRPRB

SRPRB is encoded by this gene has similarity to mouse protein which is a subunit of the signal recognition particle receptor (SR). This subunit is a transmembrane GTPase belonging to the GTPase superfamily. It anchors alpha subunit, a peripheral membrane GTPase, to the ER membrane. SR is required for the cotranslational targeting of both secretory and membrane proteins to the ER membrane. [provided by RefSeq]

Alternate Names

APMCF1, Protein APMCF1, signal recognition particle receptor subunit beta, signal recognition particle receptor, B subunit, signal recognition particle receptor, beta subunit, SR-beta

Gene Symbol

SRPRB

Additional SRPRB Products

Product Documents for SRPRB Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for SRPRB Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...