Skip to main content

SPRR3 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-13374PEP

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-13374PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SPRR3.

Source: E. coli

Amino Acid Sequence: EPCHSKVPQPGNTKIPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGYTKVPEPGSIKVPDQGFIKFPEPGAIKVPEQGYTKVPVP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13374.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-13374PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: SPRR3

SPRR3, also known as Small proline-rich protein 3, consists of a 169 amino acid isoform that is 18 kDa, and is involved in the surrounding and protection of keratinocytes. Disease research on the protein is currently being conducted with ichthyosis vulgaris, psoriasis, eosinophilic esophagitis, verrucous carcinoma, periodontitis, esophageal cancer, eczema, tonsillitis, and skin disease. SPRR3 is linked to several biological processes, including epidermis development, wound healing, and keratinocyte differentiation, in which it interacts with other proteins, such as IVL, EVPL, NFKBIA, and LOR.

Alternate Names

22 kDa pancornulin, Cornifin beta, Esophagin, small proline-rich protein 3, SPRC

Gene Symbol

SPRR3

Additional SPRR3 Products

Product Documents for SPRR3 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for SPRR3 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...