Skip to main content

SPACA3 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-89136PEP

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-89136PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SPACA3.

Source: E. coli

Amino Acid Sequence: TNNGIFQINSRRWCSNLTPNVPNVCRMYCSDLLNPNLKDTVICAMKITQEPQGLGYWEAWRHHCQGKDLTEWVDGCDF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89136.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-89136PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: SPACA3

Sperm surface membrane protein that may be involved in sperm-egg plasma membrane adhesion and fusion duringfertilization. It could be a potential receptor for the egg oligosaccharide residue N-acetylglucosamine, which ispresent in the extracellular matrix over the egg plasma membrane. The processed form has no detectable bacteriolyticactivity in vitro

Alternate Names

CT54ALLP17Cancer/testis antigen 54, LYC3Sperm protein reactive with ASA, Lysozyme-like acrosomal sperm-specific secretory protein ALLP-17, Lysozyme-like protein 3, lysozyme-like sperm-specific secretory protein ALLP17, LYZL31700025M08Rik, SLLP1MGC119058, sperm acrosome associated 3, sperm acrosome membrane-associated protein 3, sperm lysozyme like protein 1, Sperm lysozyme-like protein 1, Sperm protein reactive with antisperm antibodies, SPRASA

Gene Symbol

SPACA3

Additional SPACA3 Products

Product Documents for SPACA3 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for SPACA3 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...