Skip to main content

SMC6L1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-33378PEP

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-33378PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SMC6.

Source: E. coli

Amino Acid Sequence: KEEHGKIKREELDVKHALSYNQRQLKELKDSKTDRLKRFGPNVPALLEAIDDAYRQGHFTYKPVGPLGACIHLRDPELALAIESCL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33378.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-33378PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: SMC6L1

SMC (Structural maintenance of chromosomes) proteins are members of multisubunit complexes that play a critical role in chromosome organization, segregation, gene regulation, and DNA repair. Two of these complexes, cohesin and condensin consist of a core complex of an SMC1 and SMC3 heterodimer or an SMC2 and SMC4 heterodimer, respectively. A third complex includes a heterodimer of SMC5 and SMC6 whose function is not fully understood but is proposed to be related to DNA repair.

Alternate Names

FLJ22116, hSMC6, SMC protein 6, SMC-6, SMC6 structural maintenance of chromosomes 6-like 1, SMC6 structural maintenance of chromosomes 6-like 1 (yeast), SMC6L1FLJ35534, structural maintenance of chromosomes 6, structural maintenance of chromosomes protein 6

Gene Symbol

SMC6

Additional SMC6L1 Products

Product Documents for SMC6L1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for SMC6L1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...