Skip to main content

SLC22A13 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-82502PEP

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-82502PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC22A13.

Source: E. coli

Amino Acid Sequence: PETHGQGLKDTLQDLELGPHPRSPKSVPSEKETEAKGRTSSPGVAFVSSTY

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82502.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-82502PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: SLC22A13

SLC22A13, also known as ORCTL3/OCTL1, which is a member of the organic cation/anion/zwitterion transporter family, is highly expressed in the kidney, and to a weaker extent, in the brain, heart, and intestine. A functional study of Xenopus oocytes revealed that ORCTL3 functions in the uptake of urate and nicotinate. ORCTL3 may play a role in cyclosporine A-induced hyperuricemia, because cyclosporine A enhances urate uptake by ORCTL3.

Alternate Names

OAT10, OCTL1, OCTL3, ORCTL3, ORCTL-3, Organic cation transporter-like 3, organic cationic transporter-like 3, organic-cation transporter like 3, solute carrier family 22 (organic anion transporter), member 13, solute carrier family 22 member 13, solute carrier family 22, member 13

Gene Symbol

SLC22A13

Additional SLC22A13 Products

Product Documents for SLC22A13 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for SLC22A13 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...