Skip to main content

Novus Biologicals products are now on bio-techne.com

Better as one

SCF/c-kit Ligand Recombinant Protein Antigen, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP2-57463PEP

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-57463PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SCF/c-kit Ligand.

Source: E. coli

Amino Acid Sequence: YWKKRQPSLTRAVENIQINEEDNEISMLQEK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57463.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-57463PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: SCF/c-kit Ligand

Mouse SCF (Stem cell factor, steel factor, Kit ligand, C-kit-ligand) is a hematopoietic growth factor that stimulates the proliferation of bone marrow stem cells. SCF induces the proliferation of mast cells and primitive lymphoid and myeloid hematopoietic bone marrow progenitor cells in culture. SCF acts synergistically with both GM-CSF and G-CSF, IL-7 and EPO. Mouse SCF is active on human cells as well as murine cells and can be used for long term bone marrow culture.

Long Name

Stem Cell Factor

Alternate Names

c-kit Ligand, DCUA, DFNA69, FPH2, FPHH, KITLG, KL-1, MGF, SHEP7, SLF

Gene Symbol

KITLG

Additional SCF/c-kit Ligand Products

Product Documents for SCF/c-kit Ligand Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for SCF/c-kit Ligand Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...